Host species: Escherichia coli (E.coli) Uniprot ID: P50416 Molecular weight: 38.45 kDa His Gln406–Thr745 Datasheet MSDS Specifications Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A) Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A) Uniprot ID P50416 Uniprot link https://www.uniprot.org/uniprot/P50416 Expression system Prokaryotic expression Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET Molecular weight 38.45 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90%by SDS-PAGE Buffer PBS pH 7.5, 0.02% SKL Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Gln406-Thr745 Protein Accession P50416 Spec:Entrez GeneID 1374 Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1 Spec:SwissProtID Q8TCU0 NCBI Reference P50416 Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1 Reference PX-P4721 Note For research use only Molecular Constructor His Gln406–Thr745 Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A) Uniprot ID P50416 Uniprot link https://www.uniprot.org/uniprot/P50416 Expression system Prokaryotic expression Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET Molecular weight 38.45 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90%by SDS-PAGE Buffer PBS pH 7.5, 0.02% SKL Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Gln406-Thr745 Protein Accession P50416 Spec:Entrez GeneID 1374 Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1 Spec:SwissProtID Q8TCU0 NCBI Reference P50416 Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1 Reference PX-P4721 Note For research use only Molecular Constructor His Gln406–Thr745 Product name PX-P4721-1MG Uniprot ID P50416 Uniprot link https://www.uniprot.org/uniprot/P50416 Expression system Prokaryotic expression Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET Molecular weight 38.45 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90%by SDS-PAGE Buffer PBS pH 7.5, 0.02% SKL Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Gln406-Thr745 Protein Accession P50416 Spec:Entrez GeneID 1374 Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1 Spec:SwissProtID Q8TCU0 NCBI Reference P50416 Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1 Reference PX-P4721 Note For research use only Molecular Constructor His Gln406–Thr745 Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)” Cancel reply
There are no reviews yet.