Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Referencia NB-21-24362

embalaje : 50ug

Contact local distributor :


Teléfono : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P50416
Molecular weight:
38.45 kDa
His Gln406–Thr745

Specifications Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745
Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745
Product name PX-P4721-1MG
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745

Documents

3D Representation

Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Reviews

There are no reviews yet.

Be the first to review “Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)” Cancel reply

Related products

  • Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

    PX-P4721

    Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)