Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: P05112 Molecular weight: 16.20kDa Gly24–Ser154 His Datasheet MSDS Specifications Interleukin-4 Product name Interleukin-4 Uniprot ID P05112 Uniprot link https://www.uniprot.org/uniprot/P05112 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC Molecular weight 16.20kDa Protein delivered with Tag? C-terminal His Tag Purity estimated >38% by SDS-PAGE Buffer PBS pH 7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Gly24-Ser154 Protein Accession P05112 Spec:Entrez GeneID 3565 Spec:NCBI Gene Aliases BSF1; IL-4; BCGF1; BSF-1; BCGF-1 Spec:SwissProtID Q14630 NCBI Reference P05112 Aliases /Synonyms B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4 Reference PX-P4558 Note For research use only Molecular Constructor Gly24–Ser154 His Product name Interleukin-4 Uniprot ID P05112 Uniprot link https://www.uniprot.org/uniprot/P05112 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC Molecular weight 16.20kDa Protein delivered with Tag? C-terminal His Tag Purity estimated >38% by SDS-PAGE Buffer PBS pH 7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Gly24-Ser153 Protein Accession P05112 Spec:Entrez GeneID 3565 Spec:NCBI Gene Aliases BSF1; IL-4; BCGF1; BSF-1; BCGF-1 Spec:SwissProtID Q14630 NCBI Reference P05112 Aliases /Synonyms B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4 Reference PX-P4558 Note For research use only Molecular Constructor Gly24–Ser154 His Product name PX-P4558-1MG Uniprot ID P05112 Uniprot link https://www.uniprot.org/uniprot/P05112 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC Molecular weight 16.20kDa Protein delivered with Tag? C-terminal His Tag Purity estimated >38% by SDS-PAGE Buffer PBS pH 7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Gly24-Ser154 Protein Accession P05112 Spec:Entrez GeneID 3565 Spec:NCBI Gene Aliases BSF1; IL-4; BCGF1; BSF-1; BCGF-1 Spec:SwissProtID Q14630 NCBI Reference P05112 Aliases /Synonyms B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4 Reference PX-P4558 Note For research use only Molecular Constructor Gly24–Ser154 His Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “Interleukin-4” Cancel reply
There are no reviews yet.