Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody

Cat# NB-21-40198

Size : 100µg

Contact local distributor :


Phone : +1 850 650 7790

Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Specifications Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody

Product name ARO-A19846-100
Uniprot ID P02666
Raw Antigen Sequence RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Bos d 11, Anti-CSN2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Bos d 11
Product name ARO-A19846-1MG
Uniprot ID P02666
Raw Antigen Sequence RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Bos d 11, Anti-CSN2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Bos d 11
Product name ARO-A19846-50
Uniprot ID P02666
Raw Antigen Sequence RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Bos d 11, Anti-CSN2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Bos d 11

Documents

QC & Validation

Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody binds to Recombinant Bovine Bos d 11/CSN2 Protein, N-His in WB Assay

Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody binds to Recombinant Bovine Bos d 11/CSN2 Protein, N-His in WB Assay

Recombinant Bovine Bos d 11/CSN2 Protein, N-His(cat. No.ARO-P16698) can bind Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call