- Host species:
- Escherichia coli (E.coli)
- Origin species:
- Human
- Uniprot ID:
- Q9Y6K1
- Molecular weight:
- 34.98 kDa
His Ala628–Val912
Formaat : 100ug
| Product name | Human DNMT3A recombinant protein |
|---|---|
| Uniprot ID | Q9Y6K1 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | AEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV |
| Molecular weight | 34.98 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >85% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ala628-Val912 |
| Aliases /Synonyms | Dnmt3a, DNA MTase HsaIIIA, DNMT3A, M.HsaIIIA, DNA (cytosine-5)-methyltransferase 3A, DNA methyltransferase HsaIIIA |
| Reference | PX-P6065 |
| Note | For research use only |
| Molecular Constructor | His Ala628–Val912 |
PTX17851
There are no reviews yet.