Human DNMT3A recombinant protein

Specifications Human DNMT3A recombinant protein

Product name	Human DNMT3A recombinant protein
Uniprot ID	Q9Y6K1
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	AEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Molecular weight	34.98 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala628-Val912
Aliases /Synonyms	Dnmt3a, DNA MTase HsaIIIA, DNMT3A, M.HsaIIIA, DNA (cytosine-5)-methyltransferase 3A, DNA methyltransferase HsaIIIA
Reference	PX-P6065
Note	For research use only
Molecular Constructor	His Ala628–Val912

Documents

• Datasheet

QC & Validation

SDS-PAGE for Human DNMT3A recombinant protein

Human DNMT3A recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Human DNMT3A recombinant protein” Cancel reply