Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: Q02161 Molecular weight: 36.51 kDa Ser2–Gly87 N-GST Datasheet MSDS Specifications RHD recombinant protein Product name PX-P5200-100 Uniprot ID Q02161 Uniprot link https://www.uniprot.org/uniprot/Q02161 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG Molecular weight 36.51 kDa Protein delivered with Tag? N-GST Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ser2-Gly87 Protein Accession Q02161 Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen Reference PX-P5200 Note For research use only Molecular Constructor Ser2–Gly87 N-GST Product name PX-P5200-1MG Uniprot ID Q02161 Uniprot link https://www.uniprot.org/uniprot/Q02161 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG Molecular weight 36.51 kDa Protein delivered with Tag? N-GST Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ser2-Gly87 Protein Accession Q02161 Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen Reference PX-P5200 Note For research use only Molecular Constructor Ser2–Gly87 N-GST Product name PX-P5200-50 Uniprot ID Q02161 Uniprot link https://www.uniprot.org/uniprot/Q02161 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG Molecular weight 36.51 kDa Protein delivered with Tag? N-GST Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ser2-Gly87 Protein Accession Q02161 Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen Reference PX-P5200 Note For research use only Molecular Constructor Ser2–Gly87 N-GST Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “RHD recombinant protein” Cancel reply
There are no reviews yet.