RHD recombinant protein

Cat# NB-21-25576

Size : 100ug

Contact local distributor :


Phone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q02161
Molecular weight:
36.51 kDa
Ser2–Gly87 N-GST

Specifications RHD recombinant protein

Product name PX-P5200-100
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST
Product name PX-P5200-1MG
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST
Product name PX-P5200-50
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST

Documents

3D Representation

RHD recombinant protein

Reviews

There are no reviews yet.

Be the first to review “RHD recombinant protein” Cancel reply

Related products

  • SDS-PAGE for Atorolimumab Biosimilar - Anti-CD240D;RHD mAb - Research Grade

    PX-TA1220

    Atorolimumab Biosimilar – Anti-RHD, CD240D mAb – Research Grade