DNA repair protein RAD51 homolog 2(Rad51b)

Specifications DNA repair protein RAD51 homolog 2(Rad51b)

Product name	DNA repair protein RAD51 homolog 2(Rad51b)
Uniprot ID	O35719
Uniprot link	https://www.uniprot.org/uniprot/O35719
Origin species	House Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met121-Pro350
Aliases /Synonyms	R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference	PX-P4811
Note	For research use only
Molecular Constructor	Met121–Pro350

Product name	DNA repair protein RAD51 homolog 2(Rad51b)
Uniprot ID	O35719
Uniprot link	https://www.uniprot.org/uniprot/O35719
Origin species	House Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met121-Pro350
Aliases /Synonyms	R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference	PX-P4811
Note	For research use only
Molecular Constructor	Met121–Pro350

Product name	PX-P4811-1MG
Uniprot ID	O35719
Uniprot link	https://www.uniprot.org/uniprot/O35719
Origin species	House Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met121-Pro350
Aliases /Synonyms	R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference	PX-P4811
Note	For research use only
Molecular Constructor	Met121–Pro350

Documents

• Datasheet
• MSDS

3D Representation

Reviews

There are no reviews yet.

Be the first to review “DNA repair protein RAD51 homolog 2(Rad51b)” Cancel reply