DNA repair protein RAD51 homolog 2(Rad51b)

Referencia NB-21-24521

embalaje : 100ug

Contact local distributor :


Teléfono : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
O35719
Met121–Pro350

Specifications DNA repair protein RAD51 homolog 2(Rad51b)

Product name DNA repair protein RAD51 homolog 2(Rad51b)
Uniprot ID O35719
Uniprot link https://www.uniprot.org/uniprot/O35719
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met121-Pro350
Aliases /Synonyms R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference PX-P4811
Note For research use only
Molecular Constructor
Met121–Pro350
Product name DNA repair protein RAD51 homolog 2(Rad51b)
Uniprot ID O35719
Uniprot link https://www.uniprot.org/uniprot/O35719
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met121-Pro350
Aliases /Synonyms R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference PX-P4811
Note For research use only
Molecular Constructor
Met121–Pro350
Product name PX-P4811-1MG
Uniprot ID O35719
Uniprot link https://www.uniprot.org/uniprot/O35719
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met121-Pro350
Aliases /Synonyms R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference PX-P4811
Note For research use only
Molecular Constructor
Met121–Pro350

Documents

3D Representation

DNA repair protein RAD51 homolog 2(Rad51b)

Reviews

There are no reviews yet.

Be the first to review “DNA repair protein RAD51 homolog 2(Rad51b)” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call