Human DNMT3A recombinant protein

Cat# NB-21-26172

Size : 100ug

Contact local distributor :


Phone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6K1
Molecular weight:
34.98 kDa
His Ala628–Val912

Specifications Human DNMT3A recombinant protein

Product name Human DNMT3A recombinant protein
Uniprot ID Q9Y6K1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Molecular weight 34.98 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala628-Val912
Aliases /Synonyms Dnmt3a, DNA MTase HsaIIIA, DNMT3A, M.HsaIIIA, DNA (cytosine-5)-methyltransferase 3A, DNA methyltransferase HsaIIIA
Reference PX-P6065
Note For research use only
Molecular Constructor
His Ala628–Val912

Documents

QC & Validation

SDS-PAGE for Human DNMT3A recombinant protein

SDS-PAGE for Human DNMT3A recombinant protein

Human DNMT3A recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Human DNMT3A recombinant protein

Reviews

There are no reviews yet.

Be the first to review “Human DNMT3A recombinant protein” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody