ARO-A13850
| Product name | ARO-P13487-100 |
|---|---|
| Uniprot ID | Q06609 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD |
| Molecular weight | 20.42 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val174-Asp339 |
| Aliases /Synonyms | HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1 |
| Reference | ARO-P13487 |
| Note | For research use only. |
| Molecular Constructor | Val174–Asp339 |
| Product name | ARO-P13487-1MG |
|---|---|
| Uniprot ID | Q06609 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD |
| Molecular weight | 20.42 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val174-Asp339 |
| Aliases /Synonyms | HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1 |
| Reference | ARO-P13487 |
| Note | For research use only. |
| Molecular Constructor | Val174–Asp339 |
| Product name | ARO-P13487-50 |
|---|---|
| Uniprot ID | Q06609 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD |
| Molecular weight | 20.42 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val174-Asp339 |
| Aliases /Synonyms | HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1 |
| Reference | ARO-P13487 |
| Note | For research use only. |
| Molecular Constructor | Val174–Asp339 |
There are no reviews yet.