Cationic trypsin Protein, Canine, Recombinant (His & SUMO)
Referência NB-64-49162-20ug
Tamanho : 20ug
Remove All
Cationic trypsin Protein, Canine, Recombinant (His & SUMO)
(Synonyms: Trypsin-1, Trypsin I, TRYP1, TRY1, TRP1, Serine protease 1, PRSS1, Pretrypsinogen I, Cationic trypsinogen, Beta-trypsin, Anionic trypsin-1, Anionic trypsin I) Copy Product InfoSynonyms: Trypsin-1, Trypsin I, TRYP1, TRY1, TRP1, Serine protease 1, PRSS1, Pretrypsinogen I, Cationic trypsinogen, Beta-trypsin, Anionic trypsin-1, Anionic trypsin I
Catalog No. TMPH-00484 Copy Product Info
Cationic trypsin Protein, Canine, Recombinant (His & SUMO) is expressed in E. coli.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cationic trypsin Protein, Canine, Recombinant (His & SUMO) is expressed in E. coli. |
| Species | Canine |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P06871 |
| Amino Acid | IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN |
| Construction | 24-246 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Trypsin-1, Trypsin I, TRYP1, TRY1, TRP1, Serine protease 1, PRSS1, Pretrypsinogen I, Cationic trypsinogen, Beta-trypsin, Anionic trypsin-1, Anionic trypsin I |
| Research Background | N/A |
| Molecular Weight | 39.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
β-trypsinβtrypsinTrypsinITrypsin1TRYP 1TRY 1TRP 1Serine protease1PRSS 1PretrypsinogenIb-trypsinAnionic trypsinIAnionic trypsin1
Related Tags: Cationic trypsin Protein, Canine, Recombinant (His & SUMO) chemical structure | Cationic trypsin Protein, Canine, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

