Human adenovirus C serotype 2 DNA-binding protein (His)
Referência NB-64-49574-100ug
Tamanho : 100ug
Remove All
Human adenovirus C serotype 2 DNA-binding protein (His)
(Synonyms: Early E2A DNA-binding protein, Early 2A protein, DNA-binding protein, DBP) Copy Product InfoSynonyms: Early E2A DNA-binding protein, Early 2A protein, DNA-binding protein, DBP
Catalog No. TMPH-00896 Copy Product Info
Human adenovirus C serotype 2 DNA-binding protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.8 kDa and the accession number is P03264.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Human adenovirus C serotype 2 DNA-binding protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.8 kDa and the accession number is P03264. |
| Species | HAdV-2 |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P03264 |
| Amino Acid | SLPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF |
| Construction | 174-529 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Early E2A DNA-binding protein, Early 2A protein, DNA-binding protein, DBP |
| Research Background | Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its release from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP. |
| Molecular Weight | 45.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Early 2A-protein
Related Tags: Human adenovirus C serotype 2 DNA-binding protein (His) chemical structure | Human adenovirus C serotype 2 DNA-binding protein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

