Synthetic construction GST 26-1 Recombinant Protein

Referentie NB-21-25204

Formaat : 50ug

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
synthetic construction
Uniprot ID:
P08515
Molecular weight:
39.38kDa

Specifications Synthetic construction GST 26-1 Recombinant Protein

Product name Synthetic construction GST 26-1 Recombinant Protein
Uniprot ID P08515
Uniprot link https://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
Molecular weight 39.38kDa
Purity estimated 70%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID P08515
NCBI Reference ABS19453
Aliases /Synonyms GST 26-1 (Sta1)
Reference PX-P2092
Note For research use only
Product name Synthetic construction GST 26-1 Recombinant Protein
Uniprot ID P08515
Uniprot link https://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
Molecular weight 39.38kDa
Purity estimated 70%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID P08515
NCBI Reference ABS19453
Aliases /Synonyms GST 26-1 (Sta1)
Reference PX-P2092
Note For research use only

Documents

Reviews

There are no reviews yet.

Be the first to review “Synthetic construction GST 26-1 Recombinant Protein” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call