Host species: Escherichia coli (E.coli) Uniprot ID: Q6PB75 Molecular weight: 61.1kDa His Ser2–Arg542 Datasheet MSDS Specifications Terminal nucleotidyltransferase 4A(Tent4a)Mouse Product name Terminal nucleotidyltransferase 4A(Tent4a)Mouse Uniprot ID Q6PB75 Uniprot link https://www.uniprot.org/uniprot/Q6PB75 Expression system Prokaryotic expression Raw Antigen Sequence MGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR Molecular weight 61.1kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >65% by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ser2-Arg542 Protein Accession Q6PB75 Spec:Entrez GeneID 210106 Spec:NCBI Gene Aliases Pa; LAK; TRF; POLK; Pols; TRF4; LAK-1; Papd7; TRF4-; TRF4-1 Spec:SwissProtID G3X948 NCBI Reference Q6PB75 Aliases /Synonyms DNA polymerase sigma,Non-canonical poly(A) RNA polymerase PAPD7,PAP-associated domain-containing protein 7,TRAMP-like complex polyadenylate polymerase,Terminal guanylyltransferase,Papd7 Reference PX-P4815 Note For research use only Molecular Constructor His Ser2–Arg542 Product name Terminal nucleotidyltransferase 4A(Tent4a)Mouse Uniprot ID Q6PB75 Uniprot link https://www.uniprot.org/uniprot/Q6PB75 Expression system Prokaryotic expression Raw Antigen Sequence MGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR Molecular weight 61.1kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >65% by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ser2-Arg542 Protein Accession Q6PB75 Spec:Entrez GeneID 210106 Spec:NCBI Gene Aliases Pa; LAK; TRF; POLK; Pols; TRF4; LAK-1; Papd7; TRF4-; TRF4-1 Spec:SwissProtID G3X948 NCBI Reference Q6PB75 Aliases /Synonyms DNA polymerase sigma,Non-canonical poly(A) RNA polymerase PAPD7,PAP-associated domain-containing protein 7,TRAMP-like complex polyadenylate polymerase,Terminal guanylyltransferase,Papd7 Reference PX-P4815 Note For research use only Molecular Constructor His Ser2–Arg542 Documents Datasheet MSDS Reviews There are no reviews yet. Be the first to review “Terminal nucleotidyltransferase 4A(Tent4a)Mouse” Cancel reply
There are no reviews yet.