Mal d 1 Protein, Malus domestica, Recombinant (His)
Cat# NB-64-51117-200ug
Size : 200ug
Remove All
Mal d 1 Protein, Malus domestica, Recombinant (His)
(Synonyms: MALD1, Major allergen Mal d 1, Allergen Mal d I) Copy Product InfoSynonyms: MALD1, Major allergen Mal d 1, Allergen Mal d I
Catalog No. TMPH-02448 Copy Product Info
Mal d 1 Protein, Malus domestica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P43211.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Mal d 1 Protein, Malus domestica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P43211. |
| Species | Apple |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P43211 |
| Amino Acid | GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN |
| Construction | 2-159 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | MALD1, Major allergen Mal d 1, Allergen Mal d I |
| Molecular Weight | 19.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
MALD 1Allergen Mal dI
Related Tags: Mal d 1 Protein, Malus domestica, Recombinant (His) chemical structure | Mal d 1 Protein, Malus domestica, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

