Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

Référence NB-21-23101

Conditionnement : 100ug

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Host species:
Mammalian cells
Origin species:
Chinese sturgeon
Uniprot ID:
B2CKR4
Molecular weight:
40.94 kDa
Full-length Yes

Specifications Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

Product name Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein
Uniprot ID B2CKR4
Uniprot link http://www.uniprot.org/uniprot/B2CKR4
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MPASMPLLLLLFSALILSHSSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNYDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 40.94 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR4
Aliases /Synonyms ICSH, Lutropin, Interstitial Cell Stimulating Hormone
Reference PX-P3017
Note For research use only
Molecular Constructor
Full-length Yes
Product name Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein
Uniprot ID B2CKR4
Uniprot link http://www.uniprot.org/uniprot/B2CKR4
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MPASMPLLLLLFSALILSHSSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNYDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 40.94 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR4
Aliases /Synonyms ICSH, Lutropin, Interstitial Cell Stimulating Hormone
Reference PX-P3017
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P3017-1MG
Uniprot ID B2CKR4
Uniprot link http://www.uniprot.org/uniprot/B2CKR4
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MPASMPLLLLLFSALILSHSSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNYDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 40.94 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR4
Aliases /Synonyms ICSH, Lutropin, Interstitial Cell Stimulating Hormone
Reference PX-P3017
Note For research use only
Molecular Constructor
Full-length Yes

Documents

3D Representation

Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

Reviews

There are no reviews yet.

Be the first to review “Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call