Host species: Escherichia coli (E.coli) Uniprot ID: F6TFD9 Molecular weight: 18.3kDa His Met1–Arg159 Datasheet MSDS Specifications U1 small nuclear ribonucleoprotein C(SNRPC) Product name U1 small nuclear ribonucleoprotein C(SNRPC) Uniprot ID F6TFD9 Uniprot link https://www.uniprot.org/uniprot/F6TFD9 Expression system Prokaryotic expression Raw Antigen Sequence MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR Molecular weight 18.3kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >60% by SDS-PAGE Buffer 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Met1-Arg159 Protein Accession F6TFD9 NCBI Reference F6TFD9 Aliases /Synonyms U1 snRNP C,SNRPC，U1-C，U1C Reference PX-P4599 Note For research use only Molecular Constructor His Met1–Arg159 Product name U1 small nuclear ribonucleoprotein C(SNRPC) Uniprot ID F6TFD9 Uniprot link https://www.uniprot.org/uniprot/F6TFD9 Expression system Prokaryotic expression Raw Antigen Sequence MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR Molecular weight 18.3kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >60% by SDS-PAGE Buffer 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Met1-Arg159 Protein Accession F6TFD9 NCBI Reference F6TFD9 Aliases /Synonyms U1 snRNP C,SNRPC，U1-C，U1C Reference PX-P4599 Note For research use only Molecular Constructor His Met1–Arg159 Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “U1 small nuclear ribonucleoprotein C(SNRPC)” Cancel reply
There are no reviews yet.