Parvalbumin beta Protein, Gadus morhua, Recombinant (His & SUMO)
Référence NB-64-49440-5ug
Conditionnement : 5ug
Remove All
Parvalbumin beta Protein, Gadus morhua, Recombinant (His & SUMO)
(Synonyms: Parvalbumin beta) Copy Product InfoSynonyms: Parvalbumin beta
Catalog No. TMPH-00762 Copy Product Info
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Parvalbumin beta Protein, Gadus morhua, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.4 kDa and the accession number is Q90YK9.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Parvalbumin beta Protein, Gadus morhua, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.4 kDa and the accession number is Q90YK9. |
| Species | Gadus morhua |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | Q90YK9 |
| Amino Acid | AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA |
| Construction | 2-109 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Parvalbumin beta |
| Research Background | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. |
| Molecular Weight | 27.4 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
ParvalbuminβParvalbumin βParvalbumin b
Related Tags: Parvalbumin beta Protein, Gadus morhua, Recombinant (His & SUMO) chemical structure | Parvalbumin beta Protein, Gadus morhua, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

