Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Specifications Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Product name	ARO-P12725-100
Uniprot ID	Q9IH63
Origin species	Nipah virus(HeV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight	23.21 kDa
Buffer	0.01M PBS, pH 7.4.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ile27-Gly112
Aliases /Synonyms	Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference	ARO-P12725
Note	For research use only.
Molecular Constructor	Ile27–Gly112

Product name	ARO-P12725-1MG
Uniprot ID	Q9IH63
Origin species	Nipah virus(HeV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight	23.21 kDa
Buffer	0.01M PBS, pH 7.4.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ile27-Gly112
Aliases /Synonyms	Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference	ARO-P12725
Note	For research use only.
Molecular Constructor	Ile27–Gly112

Product name	ARO-P12725-50
Uniprot ID	Q9IH63
Origin species	Nipah virus(HeV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight	23.21 kDa
Buffer	0.01M PBS, pH 7.4.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ile27-Gly112
Aliases /Synonyms	Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference	ARO-P12725
Note	For research use only.
Molecular Constructor	Ile27–Gly112

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep” Cancel reply