Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Référence NB-21-31017

Conditionnement : 100µg

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Nipah virus(HeV)
Uniprot ID:
Q9IH63
Molecular weight:
23.21 kDa
Ile27–Gly112

Specifications Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Product name ARO-P12725-100
Uniprot ID Q9IH63
Origin species Nipah virus(HeV)
Expression system Prokaryotic expression
Raw Antigen Sequence ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight 23.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile27-Gly112
Aliases /Synonyms Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference ARO-P12725
Note For research use only.
Molecular Constructor
Ile27–Gly112
Product name ARO-P12725-1MG
Uniprot ID Q9IH63
Origin species Nipah virus(HeV)
Expression system Prokaryotic expression
Raw Antigen Sequence ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight 23.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile27-Gly112
Aliases /Synonyms Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference ARO-P12725
Note For research use only.
Molecular Constructor
Ile27–Gly112
Product name ARO-P12725-50
Uniprot ID Q9IH63
Origin species Nipah virus(HeV)
Expression system Prokaryotic expression
Raw Antigen Sequence ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDLVGDVRLAG
Molecular weight 23.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile27-Gly112
Aliases /Synonyms Fusion glycoprotein F0, Protein F, Fusion glycoprotein F2, Fusion glycoprotein F1, F, Nipah Virus (NiV) / Hendra Virus (HeV)
Reference ARO-P12725
Note For research use only.
Molecular Constructor
Ile27–Gly112

Documents

3D Representation

Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep

Reviews

There are no reviews yet.

Be the first to review “Recombinant Nipah virus/HeV F/Fusion glycoprotein F0 Protein, N-His, N-SUMO & C-Strep” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call