Recombinant Human SYNGAP1 Protein, N-His

Specifications Recombinant Human SYNGAP1 Protein, N-His

Product name	ARO-P10382-100
Uniprot ID	Q96PV0
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight	15.79 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser1186-His1277
Aliases /Synonyms	Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference	ARO-P10382
Note	For research use only.
Molecular Constructor	Ser1186–His1277

Product name	ARO-P10382-1MG
Uniprot ID	Q96PV0
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight	15.79 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser1186-His1277
Aliases /Synonyms	Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference	ARO-P10382
Note	For research use only.
Molecular Constructor	Ser1186–His1277

Product name	ARO-P10382-50
Uniprot ID	Q96PV0
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight	15.79 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser1186-His1277
Aliases /Synonyms	Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference	ARO-P10382
Note	For research use only.
Molecular Constructor	Ser1186–His1277

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human SYNGAP1 Protein, N-His” Cancel reply