Envelope glycoprotein G(US4)

Specifications Envelope glycoprotein G(US4)

Product name	Envelope glycoprotein G(US4)
Uniprot ID	A7U885
Uniprot link	https://www.uniprot.org/uniprot/A7U885
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight	42.8kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>50% by SDS-PAGE
Buffer	TBS, pH 8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ppr490-Asp649
Aliases /Synonyms	Glycoprotein G，US4，gG
Reference	PX-P4760
Note	For research use only
Molecular Constructor	GST Ppr490–Asp649

Product name	Envelope glycoprotein G(US4)
Uniprot ID	A7U885
Uniprot link	https://www.uniprot.org/uniprot/A7U885
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight	42.8kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>50% by SDS-PAGE
Buffer	TBS, pH 8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ppr490-Asp649
Aliases /Synonyms	Glycoprotein G，US4，gG
Reference	PX-P4760
Note	For research use only
Molecular Constructor	GST Ppr490–Asp649

Product name	PX-P4760-1MG
Uniprot ID	A7U885
Uniprot link	https://www.uniprot.org/uniprot/A7U885
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight	42.8kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>50% by SDS-PAGE
Buffer	TBS, pH 8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ppr490-Asp649
Aliases /Synonyms	Glycoprotein G，US4，gG
Reference	PX-P4760
Note	For research use only
Molecular Constructor	GST Ppr490–Asp649

Documents

• Datasheet
• MSDS

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Envelope glycoprotein G(US4)” Cancel reply