Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)
Referencia NB-64-49735-50ug
embalaje : 50ug
Remove All
Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)
(Synonyms: FALL39, Cathelicidin antimicrobial peptide, CAP18, CAMP, 18 kDa cationic antimicrobial protein (CAP-18;hCAP-18)) Copy Product InfoSynonyms: FALL39, Cathelicidin antimicrobial peptide, CAP18, CAMP, 18 kDa cationic antimicrobial protein (CAP-18;hCAP-18)
Catalog No. TMPH-01058 Copy Product Info
Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis-SUMO, C-Myc |
| Accession Number | P49913 |
| Amino Acid | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Construction | 132-170 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | FALL39, Cathelicidin antimicrobial peptide, CAP18, CAMP, 18 kDa cationic antimicrobial protein (CAP-18;hCAP-18) |
| Research Background | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. |
| Molecular Weight | 24.7 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
FALL 39CAP-18CAP 18
Related Tags: Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) chemical structure | Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

