Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#)

Specifications Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#)

Product name	ARO-A17403-100
Uniprot ID	P68431
Raw Antigen Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-Histone H3 trimethyl Lys27 (H3K27me3)
Isotype	IgG1
Clonality	Monoclonal Antibody
Protein Name	Histone H3 trimethyl Lys27 (H3K27me3)

Product name	ARO-A17403-1MG
Uniprot ID	P68431
Raw Antigen Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-Histone H3 trimethyl Lys27 (H3K27me3)
Isotype	IgG1
Clonality	Monoclonal Antibody
Protein Name	Histone H3 trimethyl Lys27 (H3K27me3)

Product name	ARO-A17403-50
Uniprot ID	P68431
Raw Antigen Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-Histone H3 trimethyl Lys27 (H3K27me3)
Isotype	IgG1
Clonality	Monoclonal Antibody
Protein Name	Histone H3 trimethyl Lys27 (H3K27me3)

Documents

• Datasheet

QC & Validation

SEC-HPLC of Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#)

Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#)was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#)

Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human Histone H3 trimethyl Lys27 (H3K27me3) Antibody (2E12#)” Cancel reply