DAZL Protein, Human, Recombinant (His & SUMO)
Referencia NB-64-127961-1mg
embalaje : 1mg
Remove All
DAZL Protein, Human, Recombinant (His & SUMO)
(Synonyms: SPGY-like-autosomal, SPGYLA, Deleted in azoospermia-like 1, Deleted in azoospermia-like, DAZ-like autosomal, DAZLA, DAZL1, DAZL, DAZH, DAZ homolog) Copy Product InfoSynonyms: SPGY-like-autosomal, SPGYLA, Deleted in azoospermia-like 1, Deleted in azoospermia-like, DAZ-like autosomal, DAZLA, DAZL1, DAZL, DAZH, DAZ homolog
Catalog No. TMPH-04667 Copy Product Info
DAZL Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. The accession number is Q92904.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | DAZL Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. The accession number is Q92904. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | Q92904 |
| Amino Acid | VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
| Construction | 130-250 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | SPGY-like-autosomal, SPGYLA, Deleted in azoospermia-like 1, Deleted in azoospermia-like, DAZ-like autosomal, DAZLA, DAZL1, DAZL, DAZH, DAZ homolog |
| Molecular Weight | 31.8 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 304 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
SPGYlikeautosomalDAZlike autosomalDAZL-1
Related Tags: DAZL Protein, Human, Recombinant (His & SUMO) chemical structure | DAZL Protein, Human, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

