NB-21-25206 | Synthetic SNAP Protein Neobiotech

Host species:: Escherichia coli (E.coli)
Origin species:: synthetic construction
Uniprot ID:: P08515
Molecular weight:: 45.44kDa

Unknown Yes

Specifications Synthetic SNAP Protein

Product name	Synthetic SNAP Protein
Uniprot ID	P08515
Uniprot link	http://www.uniprot.org/uniprot/P08515
Origin species	synthetic construction
Expression system	Prokaryotic expression
Raw Antigen Sequence	MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGGYEG GLAVKEWLLAHEGHRLGKPGLGAGIDAIMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEF PNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGG GDHPPKSD
Molecular weight	45.44kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Unknown
Protein Accession	AFU51890.1
Spec:SwissProtID	P08515
NCBI Reference	AFU51890.1
Aliases /Synonyms	SNAP, Glutathione S-transferase class-mu 26 kDa isozyme ou GST 26 ou Sj26 antigen ou SjGST ou Glutathione S-transferase domain-containing protein
Reference	PX-P2096
Note	For research use only
Molecular Constructor	Unknown Yes

Product name	Synthetic SNAP Protein
Uniprot ID	P08515
Uniprot link	http://www.uniprot.org/uniprot/P08515
Origin species	synthetic construction
Expression system	Prokaryotic expression
Raw Antigen Sequence	MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGGYEG GLAVKEWLLAHEGHRLGKPGLGAGIDAIMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEF PNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGG GDHPPKSD
Molecular weight	45.44kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Unknown
Protein Accession	AFU51890.1
Spec:SwissProtID	P08515
NCBI Reference	AFU51890.1
Aliases /Synonyms	SNAP, Glutathione S-transferase class-mu 26 kDa isozyme ou GST 26 ou Sj26 antigen ou SjGST ou Glutathione S-transferase domain-containing protein
Reference	PX-P2096
Note	For research use only
Molecular Constructor	Unknown Yes

Description

Generalities on SNAP Protein

Synaptosome nerve-associated protein also known as SNAP protein is component of SNARE protein complex. SNAP protein is involved in the exocytotic release of neurotransmitters during synaptic transmission. It is believed that SNAP protein controls exocytic and endocytic processes at the presynaptic terminal. Data suggests that SNAP protein is also implicated in postsynaptic receptor trafficking. However, a clear demonstration of SNAP protein localization in postsynaptic neuron is lacking. Even more so, since data suggests that this protein is located in the presynaptic location exclusively.

SNAP protein has also been suggested to play an important role in modulation of voltage-gated calcium channel-mediated (VGCC) signaling, short term plasticity, long term plasticity, dendritic spine morphogenesis, cognitive ability, learning and memory and network excitability. As such, deregulation of SNAP protein has been linked to several disorders such as early onset bipolar disorder, ADHD, increased risk of major depressive disorder and schizophrenia.

SNAP along with syntaxin and synaptobrevin (which are vesicle-associated membranes) have been implicated as central elements of an exocytotic membrane fusion complex in neurons. It is believed that SNAP protein binds directly to both synaptobrevin and syntaxin. Data suggests that SNAP is implicated in the final steps of intracellular membrane fusion.

Documents

Reviews

There are no reviews yet.

Be the first to review “Synthetic SNAP Protein” Cancel reply

Synthetic SNAP Protein

Referencia NB-21-25206

Contact local distributor :