Host species: Escherichia coli (E.coli) Uniprot ID: P01133 Molecular weight: 18.3kDa His Met608–Gly751 Datasheet MSDS Specifications Pro-epidermal growth factor(EGF) Product name Pro-epidermal Growth Factor proteins(EGF) Uniprot ID P01133 Uniprot link https://www.uniprot.org/uniprot/P01133 Expression system Prokaryotic expression Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG Molecular weight 18.3kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Met608-Gly751 Protein Accession P01133 Spec:Entrez GeneID 1950 Spec:NCBI Gene Aliases URG; HOMG4 Spec:SwissProtID Q52LZ6 NCBI Reference P01133 Aliases /Synonyms / Reference PX-P4822 Note For research use only Molecular Constructor His Met608–Gly751 Product name Pro-epidermal Growth Factor proteins(EGF) Uniprot ID P01133 Uniprot link https://www.uniprot.org/uniprot/P01133 Expression system Prokaryotic expression Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG Molecular weight 18.3kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Met608-Gly751 Protein Accession P01133 Spec:Entrez GeneID 1950 Spec:NCBI Gene Aliases URG; HOMG4 Spec:SwissProtID Q52LZ6 NCBI Reference P01133 Aliases /Synonyms / Reference PX-P4822 Note For research use only Molecular Constructor His Met608–Gly751 Product name PX-P4822-1MG Uniprot ID P01133 Uniprot link https://www.uniprot.org/uniprot/P01133 Expression system Prokaryotic expression Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG Molecular weight 18.3kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Met608-Gly751 Protein Accession P01133 Spec:Entrez GeneID 1950 Spec:NCBI Gene Aliases URG; HOMG4 Spec:SwissProtID Q52LZ6 NCBI Reference P01133 Aliases /Synonyms / Reference PX-P4822 Note For research use only Molecular Constructor His Met608–Gly751 Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “Pro-epidermal growth factor(EGF)” Cancel reply
There are no reviews yet.