DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc)
Referencia NB-64-49203-100ug
embalaje : 100ug
Remove All
DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc)
(Synonyms: rpbB, DsDNA-binding protein A, dsbA, Double-stranded DNA-binding protein) Copy Product InfoSynonyms: rpbB, DsDNA-binding protein A, dsbA, Double-stranded DNA-binding protein
Catalog No. TMPH-00525 Copy Product Info
May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions. DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 17.8 kDa and the accession number is P13320.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions. DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 17.8 kDa and the accession number is P13320. |
| Species | Enterobacteria phage T4 |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P13320 |
| Amino Acid | MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK |
| Construction | 1-89 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | rpbB, DsDNA-binding protein A, dsbA, Double-stranded DNA-binding protein |
| Research Background | May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions. |
| Molecular Weight | 17.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc) chemical structure | DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

