DEFB1 Protein, Mouse, Recombinant (His & SUMO)
Referencia NB-64-51210-20ug
embalaje : 20ug
Remove All
DEFB1 Protein, Mouse, Recombinant (His & SUMO)
(Synonyms: mBD-1, Defensin, beta 1, Defb1, Beta-defensin 1, BD-1) Copy Product InfoSynonyms: mBD-1, Defensin, beta 1, Defb1, Beta-defensin 1, BD-1
Catalog No. TMPH-02541 Copy Product Info
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P56386 |
| Amino Acid | DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
| Construction | 33-69 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | mBD-1, Defensin, beta 1, Defb1, Beta-defensin 1, BD-1 |
| Research Background | Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. |
| Molecular Weight | 20.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
β-defensin1βdefensin1β-defensin 1βdefensin 1mBD1Defensin, β1Defensin, β 1Defensin, beta1Defensin, b1Defensin, b 1Defb 1Beta-defensin1b-defensin1b-defensin 1BD1
Related Tags: DEFB1 Protein, Mouse, Recombinant (His & SUMO) chemical structure | DEFB1 Protein, Mouse, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

