Anti-Mouse FGF2/bFGF Polyclonal Antibody

Referencia NB-21-38673

embalaje : 100µg

Contact local distributor :


Teléfono : +1 850 650 7790

Clonality:
Polyclonal Antibody
Host species:
Rabbit

Specifications Anti-Mouse FGF2/bFGF Polyclonal Antibody

Product name ARO-A11106-100
Uniprot ID P15655
Raw Antigen Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)
Reference ARO-A11106
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse FGF2/bFGF (Ala11-Ser154).
Product name ARO-A11106-1MG
Uniprot ID P15655
Raw Antigen Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)
Reference ARO-A11106
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse FGF2/bFGF (Ala11-Ser154).
Product name ARO-A11106-50
Uniprot ID P15655
Raw Antigen Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)
Reference ARO-A11106
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse FGF2/bFGF (Ala11-Ser154).

Documents

QC & Validation

Anti-Mouse FGF2/bFGF Polyclonal Antibody binds to Recombinant Mouse FGF2/bFGF Protein, N-His in WB Assay

Anti-Mouse FGF2/bFGF Polyclonal Antibody binds to Recombinant Mouse FGF2/bFGF Protein, N-His in WB Assay

Recombinant Mouse FGF2/bFGF Protein, N-His(cat. No.ARO-P11135) can bind Anti-Mouse FGF2/bFGF Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Mouse FGF2/bFGF Polyclonal Antibody” Cancel reply

Related products

  • Recombinant Mouse FGF2/bFGF Protein, N-His

    ARO-P11135

    Recombinant Mouse FGF2/bFGF Protein, N-His