Recombinant Mouse FGF2/bFGF Protein, N-His

Katalog-Nummer NB-21-32735

Size : 100µg

Contact local distributor :


Telefonnummer : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P15655
Molecular weight:
18.50 kDa
Ala11–Ser154

Specifications Recombinant Mouse FGF2/bFGF Protein, N-His

Product name ARO-P11135-100
Uniprot ID P15655
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight 18.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala11-Ser154
Aliases /Synonyms Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2, Fgf2, Fgf-2, HBGF-2, FGF-2, bFGF
Reference ARO-P11135
Note For research use only.
Molecular Constructor
Ala11–Ser154
Product name ARO-P11135-1MG
Uniprot ID P15655
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight 18.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala11-Ser154
Aliases /Synonyms Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2, Fgf2, Fgf-2, HBGF-2, FGF-2, bFGF
Reference ARO-P11135
Note For research use only.
Molecular Constructor
Ala11–Ser154
Product name ARO-P11135-50
Uniprot ID P15655
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight 18.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala11-Ser154
Aliases /Synonyms Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2, Fgf2, Fgf-2, HBGF-2, FGF-2, bFGF
Reference ARO-P11135
Note For research use only.
Molecular Constructor
Ala11–Ser154

Documents

3D Representation

Recombinant Mouse FGF2/bFGF Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Mouse FGF2/bFGF Protein, N-His” Cancel reply

Related products

  • ARO-A15107

    Anti-Mouse FGF2/bFGF Antibody (GAL-F2)