Lymphocytic choriomeningitis virus (LCMV) (strain WE) GPC Protein (His & Myc)
Katalog-Nummer NB-64-51081-10ug
Size : 10ug
Remove All
Lymphocytic choriomeningitis virus (LCMV) (strain WE) GPC Protein (His & Myc)
(Synonyms: Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC) Copy Product InfoSynonyms: Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC
Catalog No. TMPH-02412 Copy Product Info
Lymphocytic choriomeningitis virus (LCMV) (strain WE) GPC Protein (His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 30.9 kDa and the accession number is P07399.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Lymphocytic choriomeningitis virus (LCMV) (strain WE) GPC Protein (His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 30.9 kDa and the accession number is P07399. |
| Species | LCMV |
| Expression System | E. coli |
| Tag | N-6xHis, C-Myc |
| Accession Number | P07399 |
| Amino Acid | MYGLNGPDIYKGVYQFKSVEFDMSHLNLTMPNACSVNNSHHYISMGSSGLEPTFTNDSILNHNFCNLTSALNKKSFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLSSSDPQSAMSQCRTFRGRVLDMFRTAFGGKYMRSGWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCRYAGPFGMSRILFAQEKTKFLTRRLS |
| Construction | 59-265 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC |
| Research Background | class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; interacts with the host receptor. |
| Molecular Weight | 30.9 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Lymphocytic choriomeningitis virus (LCMV) (strain WE) GPC Protein (His & Myc) chemical structure | Lymphocytic choriomeningitis virus (LCMV) (strain WE) GPC Protein (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

