Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)
Katalog-Nummer NB-64-48695-50ug
Size : 50ug
Remove All
Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)
(Synonyms: Holo-ACP synthase, Holo-[acyl-carrier-protein] synthase, acpS, 4'-phosphopantetheinyl transferase AcpS) Copy Product InfoSynonyms: Holo-ACP synthase, Holo-[acyl-carrier-protein] synthase, acpS, 4'-phosphopantetheinyl transferase AcpS
Catalog No. TMPH-00017 Copy Product Info
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3. |
| Species | Acholeplasma laidlawii |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | A9NHV3 |
| Amino Acid | MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV |
| Construction | 1-118 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Holo-ACP synthase, Holo-[acyl-carrier-protein] synthase, acpS, 4'-phosphopantetheinyl transferase AcpS |
| Research Background | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. |
| Molecular Weight | 20.9 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc) chemical structure | Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

