ApNPV Viral cathepsin Protein (His & Myc)
Katalog-Nummer NB-64-48738-200ug
Size : 200ug
Remove All
ApNPV Viral cathepsin Protein (His & Myc)
(Synonyms: Viral cathepsin, V-cath, VCATH, Cysteine proteinase (CP)) Copy Product InfoSynonyms: Viral cathepsin, V-cath, VCATH, Cysteine proteinase (CP)
Catalog No. TMPH-00060 Copy Product Info
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system. ApNPV Viral cathepsin Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 31.1 kDa and the accession number is Q91CL9.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system. ApNPV Viral cathepsin Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 31.1 kDa and the accession number is Q91CL9. |
| Species | ApNPV |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q91CL9 |
| Amino Acid | PLEFDWRRLNKVTSVKNQGMCGACWAFATLGSLESQFAIKHDQLINLSEQQLIDCDFVDVGCDGGLLHTAYEAVMNMGGIQAENDYPYEANNGPCRVNAAKFVVRVKKCYRYVTLFEEKLKDLLRIVGPIPVAIDASDIVGYKRGIIRYCENHGLNHAVLLVGYGVENGIPFWILKNTWGADWGEQGYFRVQQNINACGIKNELPSSAEIY |
| Construction | 114-324 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Viral cathepsin, V-cath, VCATH, Cysteine proteinase (CP) |
| Research Background | Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system. |
| Molecular Weight | 31.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
CP
Related Tags: ApNPV Viral cathepsin Protein (His & Myc) chemical structure | ApNPV Viral cathepsin Protein (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

