NB-21-40202 | Anti-Chicken Allergen Gal d I Polyclonal Antibody Neobiotech

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Anti-Chicken Allergen Gal d I Polyclonal Antibody binds to Recombinant Gallus gallus Allergen Gal d I Protein, N-His in WB Assay

Datasheet

Specifications Anti-Chicken Allergen Gal d I Polyclonal Antibody

Product name	ARO-A19850-100
Uniprot ID	P01005
Raw Antigen Sequence	AEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Allergen Gal d I
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Allergen Gal d I

Product name	ARO-A19850-1MG
Uniprot ID	P01005
Raw Antigen Sequence	AEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Allergen Gal d I
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Allergen Gal d I

Product name	ARO-A19850-50
Uniprot ID	P01005
Raw Antigen Sequence	AEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Allergen Gal d I
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Allergen Gal d I

Documents

Datasheet

QC & Validation

Anti-Chicken Allergen Gal d I Polyclonal Antibody binds to Recombinant Gallus gallus Allergen Gal d I Protein, N-His in WB Assay

Recombinant Gallus gallus Allergen Gal d I Protein, N-His(cat. No.ARO-P15710) can bind Anti-Chicken Allergen Gal d I Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Chicken Allergen Gal d I Polyclonal Antibody” Cancel reply

Anti-Chicken Allergen Gal d I Polyclonal Antibody

Katalog-Nummer NB-21-40202

Contact local distributor :